DPCstruct | MC33368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A330FPT2 | 51-177 | GDPDRVNLTDIPGPFFHGTKASLRVGDLLTPGFPSNYRPEITMNHVYFTAVKDGAGLAAEIAPVPGEPHVYVVEPTGEFEDDPNVTD… |
| A0A1I6LKA1 | 3-103 | IEINPNGIWYHGSNNIFSELRKGSTITQWRELAEAFSHQPLSLGYDDDGLIQHNGTEKGYLYIIDESIKVGKDVYQHPGTTMDLNAE… |
| A0A343VRF7 | 5-124 | None |
| A0A4Y4B6E5 | 87-206 | None |
| E6LI41 | 18-143 | None |
| A0A0M8W4K1 | 2-111 | None |
| A0A853DLA9 | 15-145 | None |
| A0A6N8HYT7 | 216-328 | None |
| A0A2G6LVT8 | 2-112 | None |
| A0A4S2UJE1 | 13-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.