DPCstruct | MC33367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 170 ± 40 aa |
| Standard deviation of domain lengths | 40.15 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1QGA3 | 2-161 | MPLEHKIPMIPGPKGAYSFTRRKVGKKLWGPKLEFDLSDPYCHETKFPYEPLHDEHLFEFFSRPINQKCLLKADLITDGMDVKCSLR… |
| A0A3M0J9J9 | 6-118 | LDLPLEVKIYVKPKSSTVFCRGKLGEKLHGPCLFNLDDPYIRRMSLQYNCLHDPHLQDYHKRKDILWMLKRQGVITRDNKVVCTVKE… |
| T1ERK9 | 9-246 | None |
| A0A4W5KD21 | 16-139 | None |
| A0A2R7VZR8 | 32-131 | None |
| A0A1J1IS55 | 13-220 | None |
| A0A1D2NL92 | 44-243 | None |
| A0A7D9EZV9 | 20-240 | None |
| A0A7R9DSR4 | 36-157 | None |
| F4WG52 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.