DPCstruct | MC33363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 165 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174KCX2 | 8-120 | QKEHAAAFTHGGKFHADDVFSAALLLHFNPQLTIQRGNRVPEDFAGIVFDIGRGEYDHHQKDSRIRENQVPYAAFGLLWEALGTEIL… |
| A0A6J1PWS5 | 5-176 | DPALPTMSIVRIGTKDGPFHCAEVLACALLKLLPQYKNASIVRSQDRSVLDNCDIVVGVGGEYDSPRHRYDHHVREFQESVSTIIKK… |
| A0A7R8XAJ6 | 142-330 | None |
| A0A415ZKH7 | 4-156 | None |
| A0A3R6IGP7 | 45-167 | None |
| A0A7U6KKD0 | 12-157 | None |
| K8F387 | 65-223 | None |
| A0A812ZQZ0 | 2-173 | None |
| A0A4V4MDN2 | 365-557 | None |
| A0A654GVN0 | 2-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.