DPCstruct | MC33362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 1 aa |
| Standard deviation of domain lengths | 0.92 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834FMH8 | 39-136 | VESRHAYYCFCSPQRLELLKKEALRVGQTPRYDNRCRHLQAEQVQEKLAQGQPHVIRFRLEEGVEPFQDLIFGWNRHEVAQVEGDPV… |
| A0A2I0U0C9 | 38-134 | LERGAAYRCFCTPQRLELLKKEALRSQQTPRYDNRCRHLTPTEVAEKLSQGLDWVVRFRLEKGVEPFQDLVYGWNKHEVADVEGDPV… |
| A0A6H9LRN2 | 269-364 | None |
| A0A396ZTQ0 | 7-104 | None |
| A0A3L8RZ71 | 68-164 | None |
| A0A6U4Q6N7 | 193-290 | None |
| A0A4W5MJF5 | 119-215 | None |
| A0A7T5UNA9 | 90-187 | None |
| A0A7R9LCS3 | 126-222 | None |
| A0A6G0V3K5 | 574-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.