DPCstruct | MC3336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7KVC1 | 1-109 | MTSISRISKEKLSDYENEIGKMPEAEDDGRVPIMVRSIRSGDVSEIKLNEISYWGPIRYEIVDNRAYWTATVNYKTTSLFGTFPTEA… |
| A0A1T4Z4D2 | 1-90 | MIAPQKDGAGAYPLLVSSLLAGDVTEFKPADVRKWGNVTEETVDGIRQWRVDLVYELTTAFGPFDVTASAYVKDGKVLRWIYTGSGE… |
| A0A4Q2YDY1 | 236-336 | None |
| A0A800JMJ7 | 230-335 | None |
| A0A2S7U2V8 | 55-132 | None |
| A0A3B9G779 | 3-102 | None |
| A0A7V2CX76 | 201-295 | None |
| A0A2E3N8A8 | 161-254 | None |
| A0A258APB7 | 207-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.