DPCstruct | MC33355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2E466 | 72-189 | LTYDYTRDPPNEYPEAHFHLHGESVAVQDMLERCGRPKHKPDDLHFPVGGRRYRPCLEDLIEFCILERLVEPRPGWEKALNESRQRF… |
| A0A5R9BCZ3 | 17-144 | VRFDYDRGSNSVPASHINVHSHHPELGWIMGRGHPKSRSVRKAPRTEALHFPTGGHRFRPSLEDILEALVVDFGLDVAAQGKELLRR… |
| A0A1I2MFC2 | 97-214 | None |
| A0A7Y0JWG6 | 23-146 | None |
| A0A238ZXK0 | 107-239 | None |
| A0A235A7I9 | 42-167 | None |
| A0A0B6VK92 | 44-177 | None |
| A0A6B1BYA8 | 107-216 | None |
| A0A132MXJ7 | 8-121 | None |
| A0A6L8JKQ7 | 107-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.