DPCstruct | MC33354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 102 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1V1S0 | 17-91 | SPDKGSAHILAWPAAMPDRFVAVAAVVADRAGRPIAANDVARAFRGANAKGVGPVLDTLAGMGRLRKLEDGRYAA |
| A0A451CQ36 | 1-71 | METTTAQTPWPKPLPEQVRLLRAALGQHPEPATVKQLAQTFKGAQTKRVAEILDTLVAMGQAREEAGRYAG |
| A0A1Z3U673 | 312-436 | None |
| A0A450YKE2 | 69-168 | None |
| A0A1V6EKG7 | 547-643 | None |
| A0A0H5QFE7 | 17-107 | None |
| A0A7V7KC99 | 41-152 | None |
| A0A2N3CFC5 | 104-180 | None |
| A0A5K1IAJ3 | 79-188 | None |
| C4KAB5 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.