DPCstruct | MC3335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2JVX9 | 91-183 | LELVKGEQPLVTEARVGQFDYWVHDLLRRSFGVADVAGRLDVLDIRCDRGTRRYGDVPAGVVWTIPESWGKCGVYMKGEPGTTFTFH… |
| A0A2E5XHI3 | 9-96 | EDIKTDRTEFFVFGTTDSGGDWGIKLYKRTMYLDNLGNALNKLKFYCQHEYRAFTFTEGQALIIPYSWEDSYLVVKGEPNATLEFIQF |
| A0A6N8F6H8 | 1-77 | None |
| A0A6N7JMC2 | 111-222 | None |
| A0A6N9B4M7 | 355-441 | None |
| A0A849GJ33 | 144-242 | None |
| A0A2E6LPR9 | 273-360 | None |
| A0A424K2N7 | 2-82 | None |
| A0A1E8CMC6 | 227-313 | None |
| A0A858R379 | 82-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.