DPCstruct | MC33345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 20 aa |
| Standard deviation of domain lengths | 19.86 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4QJT9 | 1-94 | MSELYPGHKVLESYFKEKGHFASYYGFLLLHQNTIVASSLPANNWKELNNCWTNHFLKEAKYYEKDLISIKEKTYEEQSRYTKELEN… |
| A0A2H5TYK0 | 1-95 | MSNYPGQNIIIEYLKERGSKSTYCGFLNFNSDFITASISPTDTCDNLDTVWFYHFLREAKSLFNQKTYIVIKNKVNEEHSRYIKNLQ… |
| A0A015LPQ7 | 1-138 | None |
| A0A2N0RIJ2 | 1-92 | None |
| A0A2I1GHR3 | 1-95 | None |
| A0A2Z6R9J6 | 1-119 | None |
| A0A372QUC3 | 181-319 | None |
| A0A397VDD7 | 8-118 | None |
| A0A2Z6R0X1 | 1-91 | None |
| A0A2Z6RRA3 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.