DPCstruct | MC33344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 51.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QWX1 | 1-96 | MSQLIEFYSKVCVARSVKFVTNEASKEEVGMSEGDRFSHSLAMILARDSEVVAVNLKILPNKYRVYISKNDDWLDRDIEYLDEIKQL… |
| A0A397U657 | 17-98 | IKFVVDEASEEDVILTENDKFSCNVATILVRDKEVVAVNLKLLPNKCKVYIAKNDSWSEKDHEYVNKIKEILINVSKDAPMT |
| A0A397IMB3 | 11-105 | None |
| A0A2I1GNN2 | 20-98 | None |
| A0A015NFJ9 | 19-99 | None |
| A0A2Z6R9M2 | 3-99 | None |
| A0A2N1MFH7 | 12-110 | None |
| A0A372R3Y9 | 13-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.