DPCstruct | MC33342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QU63 | 79-208 | KNDMFTSPAPVIKPVATITQRLLITKGRFFHSTPNDKNFFLITYKIIQENSDFFNENDPDYNLNYDHEFIYSYHTTNYYVKCKLLSH… |
| A0A397T5A7 | 12-126 | NASINQIIFFYTQNDITYLIQCEESSPGSITDYSFSNTLIFTHEQLNINKTYRLVCKKLSVTFIYQILNNIFFNIDFNLIEQQQREF… |
| A0A2Z6RA41 | 2-122 | None |
| A0A2I1EH01 | 3-121 | None |
| A0A397S9E5 | 1-141 | None |
| A0A397SA98 | 74-203 | None |
| A0A372Q6G5 | 1-152 | None |
| A0A2I1EWH4 | 1-118 | None |
| A0A2Z6R668 | 93-213 | None |
| A0A2Z6R7X7 | 8-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.