DPCstruct | MC3334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 212 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF07583- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C555 | 4-212 | NEIDYFVLDKLEHKKIAPNPEADKERLLRRVSLDITGLPPSLQMMDKFMADNSPNAYEKVIETLLASPAYGERMALHWMDVSRYADS… |
| A0A2E4GLY1 | 27-255 | DWWSLSEIKQPVVPEISGEENVKPIDAFVKNRLKKQNIEPSPLSDRHTLIRRLHFDLIGIPPSHEEVKDFAYSDDENSYPKLVERLL… |
| A0A7C7Z5L6 | 53-300 | None |
| A0A7Y5JL84 | 20-228 | None |
| A0A517ZYA5 | 132-366 | None |
| A0A7D8YCL1 | 188-426 | None |
| A0A800MAP2 | 269-432 | None |
| A0A2E9RTW7 | 466-702 | None |
| A0A523E166 | 131-342 | None |
| A0A357TIG6 | 26-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.