DPCstruct | MC33339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QER7 | 14-121 | GLLIYYNSTGLLTGIPSRNDIMAEFDNGMTVILQQSLSDKQPIHFMLTEVSDNTSEYVNGISSYILHITGTLINGQKAVIKITGIKL… |
| A0A2N1M4K4 | 14-113 | LTGIPTRDDIVAENDDPEGLELTAILDNAPFSCQEIPFMAIDNEGSSQKINGKYCYVLHLYGFLINGQKAVVTLLGIRVFFDILIPD… |
| A0A015MBQ3 | 1-102 | None |
| A0A397JLW4 | 74-170 | None |
| A0A372Q3D2 | 4-125 | None |
| A0A372Q769 | 6-123 | None |
| A0A2N1LDY9 | 1-81 | None |
| A0A397J6P3 | 4-100 | None |
| A0A015LIA5 | 30-148 | None |
| A0A397U4K2 | 16-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.