DPCstruct | MC33337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 240 ± 56 aa |
| Standard deviation of domain lengths | 56.22 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1F8P8 | 143-349 | MNTKPISYNNTSTIPNAKYQMSCMLTHFFSSQRVLPRVIQQKYFNYIRDKLLARHLMVYSRDHSNTERNRITKTFFYFTYKRYRFHF… |
| A0A2Z6QBH3 | 46-304 | SVYQSTSKYLNKKFKVSLLLTHFFKLQKVIPKRIQHKYFTFLRDSLYKRLSIIESQYNSTHTNNRNTRTFIRFTYKKYRFMLGIFIP… |
| A0A2I1ERW0 | 1-224 | None |
| A0A372QG40 | 91-363 | None |
| A0A372Q5G9 | 153-363 | None |
| A0A2H5RD20 | 159-450 | None |
| A0A2H5RVV3 | 102-276 | None |
| A0A2H5RBE2 | 1-284 | None |
| A0A2Z6RRF3 | 63-405 | None |
| A0A2H5R2S4 | 122-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.