DPCstruct | MC33334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 21.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397JL57 | 1-162 | MEYVVSYIYNYCDINDYQRFFDDLYETEKRYDVLSVIRPHETLKQWAIRVRVPLQKLVSEGKRSVYHVHALFLGFGKGKFVDHNYYR… |
| A0A2Z6Q5W2 | 74-240 | MEYIKNYYAYIGYSTPFDFEKALEAEKIFDNLSIIRSHETPQQWADRVRSTLRILINEKYSSYYHVFCLFGSFVQGVTETCYNNCMG… |
| A0A2N0QWX0 | 2-140 | None |
| A0A2H5RJC6 | 8-180 | None |
| A0A397JCW6 | 100-250 | None |
| A0A397JDV6 | 3-163 | None |
| A0A397JEJ9 | 380-567 | None |
| A0A2N0QRM5 | 4-141 | None |
| A0A2I1FB65 | 1-196 | None |
| A0A397IUM0 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.