DPCstruct | MC3333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 57.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8EKL8 | 1-66 | MLADKDRIFTNVYGFQPWTLDAAIMRGDWDDTKGLMARGQDALIDAVKASGLRGRGGAGFPTGTKW |
| A0A162V0M0 | 1-72 | MLKEEDKIFTNLHGQQSHDLKSSKKRGDWENTKALLDKGRDFIVEEVKKSGLRGRGGAGFSTGMKWSFMPKN |
| A0A2Z6MHN7 | 60-120 | None |
| A0A835S2H2 | 58-129 | None |
| A0A0F3NLA4 | 1-71 | None |
| A0A4Z2CES5 | 38-109 | None |
| A0A2H1BXI6 | 30-101 | None |
| A0A4D9CWN4 | 43-114 | None |
| A0A4Y7PLT2 | 16-86 | None |
| A0A3B4Z6I3 | 29-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.