DPCstruct | MC33326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 59.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8HU82 | 1-65 | MNFQSVIATLNQFWSDRGCLIVQPYDTEKGAGTKSPHTFLRAIGTAPWINCYLESLDWPRQELLL |
| A0A356UNJ2 | 1-56 | MKFQEIILALQKFWSEQGCILAEPYDVEKGAGTMNPSTFLRVLGPEPWHVAYVEPS |
| A0A0B8NRF6 | 8-62 | None |
| A0A496K027 | 5-59 | None |
| A0A6A6MBP3 | 68-127 | None |
| A0A367Q4N2 | 8-61 | None |
| A0A7J7IG17 | 37-96 | None |
| A0A150NTB8 | 1-60 | None |
| A0A7W0J648 | 1-60 | None |
| A0A1W9V978 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.