DPCstruct | MC33319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415J549 | 2-103 | QVQGQFVSYNQIENGKYEAVIYYSSTTGQKSTYELVVTVTNDVVTAIHFGNGGSVHSGFNNEGYTYSGGQLSFSRDYHGNITGASTT… |
| A0A3D4BM82 | 1-121 | MKLKILFIVMLLSFFACKKTDASYDSEETTNSDYQEETEAYPDGTYCAEIDYYNPDTGTRSTYTLNVEVENNELTVIHWPNGGWLDD… |
| A0A0B5RKR2 | 1-120 | None |
| A0A158KY83 | 1-102 | None |
| A0A7L4TPV6 | 6-121 | None |
| A0A5B8URT1 | 1-136 | None |
| A0A0A2MQ47 | 30-155 | None |
| K1ZD30 | 1-114 | None |
| A0A6G7X670 | 1-132 | None |
| A0A1F2RZF7 | 21-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.