DPCstruct | MC33315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 240 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0NQP0 | 22-235 | SYGVPAAPAVYEFTQPDGTVISVRQWGDKWLHGWETADGYSVIRDKNTGNWTYAETDADGRLVSSARIVGKFIDTDNLQKHLRPTGN… |
| A0A7S4VV29 | 1-244 | MPPYPFRYTIDLPDGTKSPPLRMNGDARYHWEETEDGFTVIDDPDGSGYLMIAERDETTGKLCSSGIKVGEGDPQKRGIQKHINPTS… |
| A0A6G7X640 | 15-220 | None |
| A0A800C5C4 | 13-269 | None |
| A0A0L6JU00 | 1-258 | None |
| A0A660XGZ1 | 1-267 | None |
| A0A1E5GPA7 | 24-226 | None |
| A0A7T9C3P7 | 22-284 | None |
| A0A3E4QM69 | 10-240 | None |
| A0A1H1NHY6 | 35-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.