DPCstruct | MC33311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D3V2E8 | 1-127 | MNSLFASIFRRAPEVRENLPVFPYAINKNPYTCKRTWPPDFTQLSPKHKFRLERRYRRRAKLKWARPQWTKFVKLSTWASIAFVCVY… |
| A0A6J3LZB1 | 5-118 | AFNWLFRRAPKAPVQVPEYAWNIHTNPYQCKRTWPPEFSKLSNTHQFSLERRYRRRTKLKFARPVWTRFTKLVQWGMITGFVFYGVL… |
| A0A135SL31 | 40-169 | None |
| A0A167GAH0 | 68-208 | None |
| S3C771 | 40-167 | None |
| A0A178ELD3 | 1-147 | None |
| F0X6T9 | 27-129 | None |
| A0A3M7DMU2 | 5-130 | None |
| A0A6A5XVP7 | 1-136 | None |
| A0A0A2LGV9 | 141-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.