DPCstruct | MC33310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 160 ± 16 aa |
| Standard deviation of domain lengths | 15.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D3UTV7 | 17-181 | PNYTTTISIRPAYWKLIPYASLPRPQGTASALKIRLRALGVYVKISATAKRCEKLLHRFERGLLAYEDLSTSQLTIFAHDRGLPCQP… |
| A0A2G5HJF0 | 7-169 | TGGYPLLRQWDYQKSFWKLRCDAHLTKPEIRALLRDAGRPVKFSTPKEELLQKQIRGQRGLLNYDQCSVAELRAFCIARGLASSQEA… |
| A0A1V8UG02 | 4-169 | None |
| A0A4U0XQR0 | 2-142 | None |
| A0A1V8V5P3 | 4-145 | None |
| A0A1Y6LYA5 | 1-162 | None |
| A0A3M7H6R5 | 1-156 | None |
| A0A4S9K685 | 1-192 | None |
| A0A1V8SIS4 | 4-169 | None |
| A0A139H950 | 460-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.