DPCstruct | MC3331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 3.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0XNE9 | 6-61 | MRTRLTLRPGQRGTKKLLAKYGDRLVCVRYRYDEAKKKRFKTVELIVEEIDWEPED |
| A0A2H6F5T6 | 1-51 | MQTKLTLLPGRSGTKKLLRQYGDQLICVRYRYDDYHKKRYKTVELIIEETP |
| A0A1F7MXZ7 | 60-116 | None |
| A0A2D4SG08 | 1-55 | None |
| A0A5S9MSW0 | 1-55 | None |
| A0A2T5R3Z6 | 6-56 | None |
| H5WP27 | 11-66 | None |
| A0A081C4T5 | 1-53 | None |
| A0A318EDR7 | 23-79 | None |
| A0A3B0ZHS1 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.