DPCstruct | MC33309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 287 ± 35 aa |
| Standard deviation of domain lengths | 35.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6S090 | 4-271 | GTQLDTNPGETMRLAVERFRTKMESSNRQFIQDRINEIEAMHLSTEKEKLRIMSRYWDNLGDKGQSNWSDDAPRDMVRQAREMANVS… |
| A0A2D3UQN5 | 1-306 | MSATNAEASHNFGLPIRGGDGIELSLERKTSIENALRKYRNRVLEINIASLESAISDLETREIRPTTSPEELLGRRMEELAAEYGIR… |
| A0A1Y6L2R9 | 1-262 | None |
| A0A2G5I8R0 | 3-282 | None |
| A0A1J7JZF5 | 5-292 | None |
| A0A3A2ZU59 | 1-267 | None |
| A0A074VGA0 | 16-287 | None |
| A0A7C8IKM1 | 2-237 | None |
| A0A319F5A0 | 2-327 | None |
| A0A167PRB7 | 3-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.