DPCstruct | MC33305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366JQY8 | 18-173 | GHLIYVDATGPVGKKVNAHFGIFAENGEKTAVIEMAAVAGLKHVPLQERNPLLTTTYGVGELILAALDFGADRILIGCGDSGTSDGG… |
| A0A378F2T3 | 1-118 | MWQQQRCTSPYGLSLQADFLILPGERAIIEMAQSCGLELTPPAQRDVRQASSYGLGEQVKAALDAGCRHLIIGLGGSATNDGGIGFA… |
| A0A2P1G4L8 | 55-231 | None |
| A0A2T2XAB7 | 58-188 | None |
| A0A2W5SXE2 | 134-292 | None |
| A0A447N6H1 | 375-556 | None |
| A0A6N6X5M5 | 1-130 | None |
| A0A0F9IS93 | 62-231 | None |
| A0A522QWC4 | 22-171 | None |
| A0A512DEA5 | 36-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.