DPCstruct | MC3330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 260 ± 29 aa |
| Standard deviation of domain lengths | 29.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8CRW7 | 1-225 | MMYLTSSLNLSLRSVQEDEVRIGRCLGKISVEFALGEMARRIEEGAEMPRGRQTGSNRADDSEFLAGPISNSTLGRCMDSVILEGSA… |
| A0A179HGB9 | 742-1021 | RGGLTLAFGPPRVPVNQMDRELCGMFPPIPNTLWLLHVEKRKLLLHVVLLLVLSLQDYNANARVFLLNLTSALNLTLAIYHGEELRI… |
| A0A455BC95 | 10-223 | None |
| A0A369GX33 | 390-641 | None |
| A0A0G2F3P2 | 470-780 | None |
| A0A0G4MH57 | 611-931 | None |
| A0A6A6YZT3 | 60-340 | None |
| G3JSA7 | 431-688 | None |
| A0A842Z640 | 3-267 | None |
| A0A395S0N6 | 171-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.