DPCstruct | MC333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016TTY6 | 41-122 | ETILTAKGVVTYEEIDRNVFQPNNYKIVENSFPIPRLDFIVRPSCAKIFYEWLEIAKQAVPPDPPREIKETQKNAFLLNGYS |
| A0A183GWV9 | 9-108 | RAIVTAKGIASYAEIERNVFRPNNYFIEEASYPIPKLRFIEKPTCGKIFGDWLEIARSHTRAKFPPREIDESQKNAFLLNGYAKLYK… |
| A0A016WBW5 | 1-106 | None |
| A0A0B2VCI6 | 52-141 | None |
| A0A0M3IRZ3 | 20-115 | None |
| A0A016TSX7 | 66-167 | None |
| A0A6V7W1G7 | 1-97 | None |
| A0A016WCS6 | 11-103 | None |
| W6NHF2 | 1-92 | None |
| W2T729 | 80-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.