DPCstruct | MC33298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 120 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 86.74 |
| Assigned Pfam label(s) | PF00082- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JZK3 | 132-249 | MNGTSMSSPNACGGIALVLSGLKQSGIPPSVPAVRRALENTAQKVDDIEVFAQGHGIIQVDKALDYLTQHASLPTSRLGFSVSVGSQ… |
| A0A816HQT7 | 1-124 | MNGTSMASPNAAGCVALLLSALKQEQIEYNPSLIRRALMNTAQKIDDEFSIGAGLLQIHKALDYIRSLAKPSLISKMQFDITGGQGR… |
| A0A6J1WPK3 | 2-114 | None |
| A0A6H5GJE3 | 458-571 | None |
| A0A7J7N5D0 | 565-689 | None |
| A0A822EX49 | 186-308 | None |
| A0A672SJJ0 | 132-249 | None |
| A0A2G2X6T0 | 343-472 | None |
| A0A7R9PW68 | 200-314 | None |
| A0A5E4QC44 | 272-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.