DPCstruct | MC33295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 244 ± 31 aa |
| Standard deviation of domain lengths | 31.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816HHR2 | 7-218 | IFGSHLLYSHPQSLKEMKSKFNDIRPVNKKYTSNDGGDYRARVCNVGIGAFLHELGHSFGLHHNYGVMLRGFDDFNRAFYSVELSTN… |
| A0A3D1IAH5 | 151-414 | KDGGELWGLFYGWLDKRFPFSRNKCLVIMGFTGYDRKERKALAHTALGGGGEALFGGATIHSWPRSLRQVSRVFLDATPVDPALMLD… |
| J3KC58 | 229-475 | None |
| A0A261XY17 | 148-387 | None |
| A0A0D7A0A5 | 177-417 | None |
| A0A4S4M3I7 | 1-346 | None |
| A0A0B2UT31 | 20-207 | None |
| J9FFZ1 | 60-297 | None |
| A0A395IUA1 | 252-528 | None |
| A0A4Z1J4I5 | 21-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.