DPCstruct | MC33293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3X7Q7 | 23-118 | WKQELALSYKVSRGETKWEGRAYLPWSYFPPNVTKFNSFAIHGSKDKRNYEALSPVPQHELQQGQKPDFHRLEYFKPFSFNTLLGEE… |
| A0A816HH66 | 1-92 | MLPLPFYQVERPSSTRWIGRARIPRSLFPAHVDRFNAYAIHGENDQRTYESLYPAPSDSVKPDFHRLEFFRSIDFESLLNIGEHDGD… |
| A0A815WSD9 | 7-99 | None |
| A0A0B2VR95 | 236-320 | None |
| A0A1I8D0V8 | 66-142 | None |
| A0A7R9MPF5 | 29-107 | None |
| A0A4X2MDY6 | 1-101 | None |
| A0A6I8PUI1 | 69-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.