DPCstruct | MC33292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 66.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816HGX3 | 2-152 | FNNSNSNNRSTTGGSFDFSVNDVCDRLEKEFTHMQGERTQLRIECEKLNAEKNEVQRQYCLYYEMAYRLSYEMHKQTEISKRLVALL… |
| A0A674BUR5 | 1-122 | TQRVPIQPGQSFKFTVLETLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYIMYYEMSYGLNIEMHKQAEIVKRLSAICAQII… |
| A0A672JUV9 | 11-150 | None |
| A0A834JU46 | 47-218 | None |
| A0A1S3FP06 | 146-292 | None |
| A0A1S3FNT8 | 1-155 | None |
| A0A4Z2H1I1 | 10-156 | None |
| A0A2J8WPG8 | 9-180 | None |
| A0A6P7GK74 | 5-137 | None |
| G3R592 | 71-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.