DPCstruct | MC33290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L4YCB7 | 1-59 | MSRLILFNKPYGVLTQFTDAGGRPTLADYIPIAKVYPAGRLDADSEGLVVLTDDGALQV |
| A0A554TZK6 | 247-304 | CRYVVFHKPYGVLSQFTPEGRWRGLNEFGLPPGVYAAGRLDADSEGLLLLTDDGPLIK |
| A0A3N7A1J5 | 531-597 | None |
| A0A0M0EBC9 | 195-248 | None |
| A0A250KXI5 | 1-59 | None |
| A0A2V0QJH4 | 34-127 | None |
| A0A7S0AM87 | 323-392 | None |
| A0A6L5C6U8 | 2-69 | None |
| A0A806J107 | 25-88 | None |
| A0A3R8LRH0 | 512-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.