DPCstruct | MC3329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 392 |
|---|---|
| Mean domain length (aa) | 162 ± 35 aa |
| Standard deviation of domain lengths | 34.98 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 69.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.52 |
| Pfam Score | 98.56 |
| Assigned Pfam label(s) | CL0123- CL0016- CL0274- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8CQQ9 | 9-165 | QRAPRVSWTPDYEGTFFRSLWESVLKGLRDNATGTLKSEAWAKAAHDLWNTHQVRLEKNHLKNKADNARKRFKAWRGLRDNPAFKYN… |
| A0A0S3RM94 | 2-112 | DARLLHSMIEESRLSNRVDRSWTSQAYSNIVDHLHSCGYVALTKNNVKNRQKVLKDKWREVHDLFAGLSGFAWNAVNMTFEAEAEVW… |
| M7Z768 | 16-188 | None |
| M7YZF4 | 62-264 | None |
| A0A6P6FYH7 | 102-226 | None |
| A0A5C3MF22 | 2-120 | None |
| A0A0E0MF79 | 36-177 | None |
| A0A446LZN8 | 4-117 | None |
| A0A443N024 | 25-225 | None |
| A0A3S3R980 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.