DPCstruct | MC33288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9BJQ3 | 35-155 | TAFVAILYASDQKRAVVLMADGNYGASITNCAEELVTFLHRFHLEPAPVALADIRWIYRDSVGNWDEIVPSVVHGTQIYCVNYRPLD… |
| A0A6I1NQI4 | 1-86 | MAKYTIQAINDLHVIIIDDLDETLPTVTNSAASVIDDLNSRIGGLGTRRVFYRDSIKRYDELQHEDGRFTGFAACGPGQQEFLKTI |
| A0A6L3SXI3 | 21-132 | None |
| A0A7D5YJN2 | 3-76 | None |
| A0A7X7IHS3 | 1-94 | None |
| A0A7Z8VYT4 | 50-144 | None |
| A0A656Q928 | 18-153 | None |
| A0A5E4PH81 | 12-109 | None |
| A0A7Y6KAD1 | 2-107 | None |
| A0A839GUG3 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.