DPCstruct | MC33286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 157 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 87.12 |
| Assigned Pfam label(s) | PF13828- PF13845 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8CKB9 | 122-253 | VWPAGTCLGIDLSANQPNDVPVDCAAPHAMEVTGTVNLAEKFPAALPSEAEQDTYIKDTCTRLTDAYLAPVQLRNTTLTLIYSTISL… |
| A0A6J6VAV8 | 34-185 | LIDRGDDDRSRTPTTPDVTTASRAASNPTPTSGVDANVSVFSLAPGSCIDQNDLTTGLVTTVKSVPCDQPHSHEVYFKTSVTPADQA… |
| A0A7K1VM76 | 18-157 | None |
| A0A7Y0JQU9 | 2-199 | None |
| A0A3A5HAL4 | 31-269 | None |
| A0A838RFA0 | 226-355 | None |
| A0A2R2WCT9 | 665-864 | None |
| A0A0N0ATQ6 | 41-199 | None |
| A0A6L8N8E9 | 164-349 | None |
| A0A3N4YVT5 | 167-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.