DPCstruct | MC33283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 215 ± 36 aa |
| Standard deviation of domain lengths | 35.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817V0U1 | 1-226 | MQNYKESSKFSLHESYRLTTKDVKFFGKVVLPLVEKYFQAHREYFITPSSLKTGTSYATVKEKEMSCSLFCKLAFLLRQKFGAFGNE… |
| V9IG41 | 194-433 | MKLLKPSDTFSRRNSFKTSTRDIKFFSKVVLPLMEKYFSTHKNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPD… |
| A0A3Q0IX53 | 542-780 | None |
| A0A819Q4P8 | 296-521 | None |
| A0A6V7X1X4 | 471-639 | None |
| A0A437BYD6 | 178-390 | None |
| A0A7R9CHX1 | 92-381 | None |
| A0A4U5NU09 | 24-212 | None |
| A0A4Z2AZD4 | 349-598 | None |
| A0A0S7K084 | 53-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.