DPCstruct | MC33282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 317 ± 62 aa |
| Standard deviation of domain lengths | 61.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817UHV3 | 7-286 | EQRLAELKGRIASQLGQLLPVPVEDRDRPVHVTIDKEGRTIDSLTGEVLQIPSRIPTLKANLRVQKKDVIKQEHPKAKQYKEVIIEH… |
| Q6BJ33 | 1-364 | MSYRKRPFEKNGNGESKRIKESSSTDTTDAIARAKARLLEKNKNGTPEQTGHRHSNNPHRVDTLSSKIDSAKKRLNNQDSEREREER… |
| H2PQH7 | 128-505 | None |
| E9I984 | 4-262 | None |
| A0A7S1SMC0 | 1-304 | None |
| A0A6D2LGU3 | 495-832 | None |
| A0A1X2IP71 | 1-378 | None |
| F4PPM2 | 323-690 | None |
| A0A0V1A0Y6 | 514-902 | None |
| A0A0D8XIS8 | 146-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.