DPCstruct | MC33279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 363 ± 44 aa |
| Standard deviation of domain lengths | 43.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RXC8 | 446-750 | MFTTGAEICAKPPFDIQPINKGFFQRLPKYLQEKLKPINEYERNIAFGQAHRFWIEPDKLNYEIVQRETSTLFLVGDVRLRVRKHLL… |
| A0A817TWU0 | 1-410 | MFTTGTEVCAKPPFEMRSIDESFFQRLPEHLQQKMKPLHKCERYFSFGRAHRFWIEADEVIYEQQETETNTIFRVADVCLRVRKHLL… |
| A0A818AKK2 | 60-450 | None |
| A0A814SNH6 | 546-931 | None |
| A0A819EF13 | 546-954 | None |
| A0A815VXJ1 | 454-754 | None |
| A0A820ZJN1 | 1-388 | None |
| A0A817LR31 | 176-474 | None |
| A0A816SYN9 | 197-553 | None |
| A0A821WX39 | 3-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.