DPCstruct | MC33278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 28.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817TI18 | 28-187 | GLPSFQLWSSTQKNQEPFCSSLTFLTAEQRYYCQTNSKIFSIISRSLRQAIEECQYQFRNQRWNCSIFNQSDVFGKLVLRKTPETAF… |
| E9PVI8 | 25-151 | IKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNLELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRES… |
| A0A6L5C867 | 1-126 | None |
| A0A556TK44 | 671-836 | None |
| A0A3Q3AEW6 | 161-356 | None |
| A0A3Q3AX03 | 133-283 | None |
| A0A139WF66 | 219-418 | None |
| S4RLQ5 | 5-160 | None |
| A0A3P6RQL2 | 2-157 | None |
| A0A3Q0JEQ4 | 69-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.