DPCstruct | MC33274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 54.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194RDL0 | 27-108 | MSDKGFNVQIGIDPETGFPFGGNDANCGTWMDKMGSSEAAGTRGKPATPRDGSAVELVALAYSVASWLAAQHRAARFPYPGV |
| A0A817SPE4 | 25-111 | MTDQSFNNEIDINRCTGFVYSESRWNCGSWMNKMGSSQKALNKDYSATPRHGSAIELVGLCRATLVWLIQMNKYGHYPYHSIEISSG |
| A0A814V5X0 | 722-805 | None |
| A0A814YCY8 | 117-184 | None |
| A0A183J954 | 16-97 | None |
| A0A817LAF4 | 362-447 | None |
| A0A0B1TUK7 | 390-476 | None |
| A0A015KBU5 | 1-87 | None |
| A0A821GKD6 | 1-87 | None |
| A0A2G9RJZ8 | 144-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.