DPCstruct | MC33271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5041 |
|---|---|
| Mean domain length (aa) | 232 ± 52 aa |
| Standard deviation of domain lengths | 51.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.05 |
| Pfam Score | 72.57 |
| Assigned Pfam label(s) | CL0221- PF01412- PF14008- PF18701- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817SF84 | 19-232 | PIFSGHPSEDVELFLRSIKNITKANDESENHEILEIVRGKLTQSAGLWFDNNEHNFKKWSDFEIAFRNRYFSTTMIHKKFNKLKQRT… |
| A0A6P7VZY8 | 4-165 | TPTYSGYSDAASVHDFLQDLDAYIAALGASDETALIQIVPIALTDDAARWRRMQRPFLSMADFRTRFREEFLPPDYEMRIRDELASR… |
| A0A0R3UFP8 | 17-225 | None |
| A0A4V4HAU1 | 12-322 | None |
| A0A4S8M835 | 143-447 | None |
| J6F686 | 4-297 | None |
| J6F537 | 8-267 | None |
| A0A6I9Y9M0 | 848-1061 | None |
| J5TDH1 | 4-181 | None |
| A0A0G4HQC0 | 7-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.