DPCstruct | MC33270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 223 ± 34 aa |
| Standard deviation of domain lengths | 33.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 87.70 |
| Assigned Pfam label(s) | PF02251- PF02252 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817RZI5 | 5-189 | KNNKIFTELYTNIKQQAEKSLTNLVEHAYEIENFLKKNFFSNNEIIIMENLNSSNHHLNLIIQPVQNYLRDFIEIVEHLTIWLELEI… |
| A0A6J1V6I1 | 3-161 | TEKEEKEAPKCGYLKGNEVLISLLDRVKPEVREFKEKCILVTTWIQFMIPKIEDGNDFGVAVQEKVLERITALKTKADAFQTTIAKY… |
| A0A7N4NSK5 | 20-188 | None |
| A0A5J5CHB2 | 6-211 | None |
| A0A7J6PDD8 | 240-479 | None |
| A0A7J6PGS8 | 25-185 | None |
| A0A146KF25 | 5-222 | None |
| A0A813YDG3 | 750-1021 | None |
| A0A3R6WSQ4 | 457-700 | None |
| E4Y751 | 12-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.