DPCstruct | MC33269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 4.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00953 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8W795 | 55-140 | LPFISINLATFSFNFYPSRGFVGNTLTYFCGIFLAVVSIFGHYSKTLILFLIPQFLNFFLSLPQLFNFIPCPRHRLPTINTKTNKL |
| A0A453AT50 | 68-150 | LPFLTTSLALLGFNWYPSSVFVGDTYTYFAGMTLAVVGILGHFSETLLLFFLPQVLNFLCSVPQLFHFVPCPRHRLPRFDTQT |
| A0A4T0M396 | 51-138 | None |
| A0A813V6L7 | 1-82 | None |
| W7JU79 | 33-118 | None |
| A0A0A9XH31 | 3-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.