DPCstruct | MC33264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8UBW1 | 4-157 | MDGCLKPVRGRSLPLNVEPQWACEELLAAAIKKQKAFNQDLEDGAHVLLYPDARVITNIPGTDTPFTVQMYKEAIGKPYQRITLYIC… |
| A0A834KXU6 | 95-229 | KAGKLKPVRGTALPLAVNPDLDAAHLRTAALQKLQDFYTNLKIGSFFLLYPDGTEIINIPGTETPFTVRGYKEALGKAYQRITVYIC… |
| A0A7D9M1A6 | 102-258 | None |
| A0A7D9HKR6 | 105-263 | None |
| A0A7D9HBX8 | 113-266 | None |
| A0A6P8VWM4 | 1-154 | None |
| A0A6S7J110 | 4-162 | None |
| A0A6P6MRV1 | 129-255 | None |
| A0A5C6MEY2 | 267-416 | None |
| A0A6P8VUC7 | 99-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.