DPCstruct | MC33263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 194 ± 13 aa |
| Standard deviation of domain lengths | 12.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7FNE1 | 261-453 | RRLKSAENIIQIAEATNLLEWFYDEDEETGILRCLPCFELYMASRPNLANLTPLRAQRLLSSSSSGTFATGILLKKETTRLLIQGHN… |
| A0A7D9DKB7 | 1-199 | MPTPLSAIGAKCSHEVSELLLKWPDIKNIIDLVNCCRHIHFFLGDVTKGVLSVIRYETCYQYLEYNKNGIHGFINTKPEQVAKKGLG… |
| A0A6S7GSJ1 | 1-214 | None |
| A0A6S7FRE6 | 199-399 | None |
| A0A7M5XBT3 | 69-245 | None |
| A0A6S7G8H7 | 29-226 | None |
| A0A7D9EFA7 | 622-816 | None |
| A0A6S7JEV8 | 152-347 | None |
| A0A7D9I761 | 333-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.