DPCstruct | MC33261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 129 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20478 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TPZ2 | 3-87 | TPAEDVCCGRLSCITNYGHFYNICLDQQVLTVAIHQRSDIRADPMNYSSESFRKSAYRQNILWKYKKLGRGNRRVCPSCVVLAIR |
| A0A7D9DDB9 | 145-268 | NTGEQELPGRATNYNCTCGYCRNMPTSKEEVCCKEKKNCRAKSMAFYNSCIESDNLSTAIRNMGDTYVFTPTYDNRAMRHAAYRQYI… |
| A0A7M7HCT2 | 13-113 | None |
| A0A803JMJ7 | 138-272 | None |
| A0A803JI63 | 613-767 | None |
| A0A803JFR1 | 160-306 | None |
| A0A2G8LB27 | 524-651 | None |
| A0A2G8L5Y9 | 40-111 | None |
| R7TAP7 | 66-195 | None |
| A0A7M5XJH2 | 20-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.