DPCstruct | MC33259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 153 ± 27 aa |
| Standard deviation of domain lengths | 26.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 90.08 |
| Assigned Pfam label(s) | CL0263- CL0194- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9D8A2 | 158-301 | CFHNCESEKSLATHEETCSLVNGVQAVKLPKEGTKIKFKNHKNQLLVPFVIYADFESLLVSDRDRKLDDSADESYTNRYQTHHACSF… |
| X1XN07 | 1-141 | MPKEGECAEFKAWRNTQRHPLVIYADFEAILVKTEEKRGGSTTVIQNHEAMSYGVLVKASEDVPAELLLQHEIPAGPVIYRDSENRK… |
| A0A6S7GEE1 | 18-185 | None |
| A0A6S7GDG8 | 624-810 | None |
| A0A6S7G2B3 | 1-116 | None |
| A0A6S7G1Y7 | 33-210 | None |
| A0A5N4A6F4 | 186-352 | None |
| A0A5N4AIN6 | 556-668 | None |
| A0A6P8GXT6 | 260-411 | None |
| A0A5N3ZZT3 | 13-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.