DPCstruct | MC33256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 306 ± 24 aa |
| Standard deviation of domain lengths | 24.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7KUR8 | 1-314 | MAKFARIFLLLATVQADMYLHNPRGSNNRLDEAKRERNNANRLFDSQNNNRGGYNVGSLYYYQESMLSVEWTNQHSCGDQNTHCEII… |
| A0A6B2KZZ5 | 10-307 | LSLVLGALGDVYLHNPRGSNNRNRETGTNVNNANRMYDSQNNNKGGYCWGPPMTFYEKSLLQVEWTAQHGCGTDNNNVDCDLILQYM… |
| A0A815FJX4 | 108-360 | None |
| A0A820ZF20 | 3-309 | None |
| A0A6J8E1U2 | 3-318 | None |
| A0A812QWP0 | 3-313 | None |
| A0A812LZ11 | 2-361 | None |
| A0A7S4HTS0 | 21-334 | None |
| A0A817EM06 | 619-902 | None |
| A0A7D9JFE7 | 9-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.