DPCstruct | MC33247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4760 |
|---|---|
| Mean domain length (aa) | 134 ± 28 aa |
| Standard deviation of domain lengths | 28.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.41 |
| Pfam Score | 93.32 |
| Assigned Pfam label(s) | CL0020- PF09673- CL0613- CL0080- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2A849 | 9-134 | FGDKVNSKTLKGKILVINFWFVGCAPCVQEIPELNKLVKDYERDSSIVFIAIALDKPWDIKDFLKKRPFYYKIIGDGRLTAKGYDVR… |
| A0A1B6NV80 | 11-140 | YISSPSPYQDVVSAQQSAVKQDKLLLVVLGAQWCHDSTGLAERFSTKEMDLILRAHYETVFVDVGTLEDRRNITERFDYPIYYATPT… |
| A0A378NA57 | 2-90 | None |
| A0A1P8W8V7 | 167-328 | None |
| A0A7R9U210 | 200-311 | None |
| A0A7W1HHH9 | 64-181 | None |
| A0A4Y7NJ76 | 407-512 | None |
| A0A6J7RF64 | 10-107 | None |
| A0A353RWF6 | 18-173 | None |
| A0A4Z0W0X1 | 227-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.