DPCstruct | MC33244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 133 ± 31 aa |
| Standard deviation of domain lengths | 30.66 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0XAA5 | 7-119 | IAPIEVQELIEAHPDAEVMAHPECTRETRKLAHYVGSTSQMLRHAKESGSKKFIVVTEKGLVYRMQKEMPNKTFIPVETAICTNMKK… |
| A0A4V1URG6 | 22-139 | IDPTLDLFAEIEKLKKEKNAVLLAHYYQEPDIQDVADYIGDSLGLAQEAAKTDADIIVFAGVHFMAETAKILNPKKKVLLPDLNAGC… |
| A0A6S6RUT7 | 2-103 | None |
| A0A447LBK3 | 1-73 | None |
| A0A7V8SZD3 | 92-196 | None |
| C6SIG0 | 36-139 | None |
| A0A6I9RPR4 | 131-293 | None |
| A0A4S4DJZ7 | 181-291 | None |
| A0A2H0PLJ6 | 128-229 | None |
| M5RX17 | 52-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.