DPCstruct | MC33243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 375 ± 57 aa |
| Standard deviation of domain lengths | 56.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 65.12 |
| Assigned Pfam label(s) | CL0126- CL0159- PF07589- CL0202- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q6B6F5 | 1-384 | MKNLYAFLSVFFFLSASVSAQVPKLNSYPSAAAVIYLDFDGHIIEGTSWNFEGPVVCNGANLNATQLTEIFNRVSEDYRPFNINVTT… |
| A0A6M0AUI7 | 4-284 | DFSPFNVNVTTAQPSDDQLKKTSGSDSEWGIRVVIGGDGSWYNKPGVVGVGYLDSFNDDIDTPTFVFSEVYNGSEKGVAETISHEVG… |
| A0A517TTG6 | 16-348 | None |
| A0A383W5S7 | 49-412 | None |
| H5WUS2 | 3-312 | None |
| A0A6M0G1P3 | 39-405 | None |
| A0A6P1AE50 | 1-401 | None |
| A0A7W0V802 | 2-268 | None |
| A0A0D2MSH0 | 2-348 | None |
| A0A3D3CRV0 | 2-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.